PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo16G0056400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family Whirly
Protein Properties Length: 136aa    MW: 15057.4 Da    PI: 9.8732
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo16G0056400genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly146.11.3e-45221311110
           Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkal 94 
                      s++k+kaal v +v+p+f+ +dsgn ++k++G++ll++++a+++rkyd ek+q fals+tev+ l++l+++esceffhdp++k+s+eG+v+k+l
  Spipo16G0056400  22 SIFKGKAALIVSPVLPKFSMMDSGNSVVKKKGSVLLKFMPAVGTRKYDPEKRQLFALSPTEVGCLISLGPEESCEFFHDPSMKSSQEGEVKKSL 115
                      79******************************************************************************************** PP

           Whirly  95 kvePlpdGsGlfvnls 110
                       v P ++  G+f+ ls
  Spipo16G0056400 116 TVSPTSNDGGYFFTLS 131
                      *************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.101.2E-4613132IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544472.12E-4216132IPR009044ssDNA-binding transcriptional regulator
PfamPF085363.3E-4323131IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 136 aa     Download sequence    Send to blast
VSEWIFNLGA QSRWRRTFAD FSIFKGKAAL IVSPVLPKFS MMDSGNSVVK KKGSVLLKFM  60
PAVGTRKYDP EKRQLFALSP TEVGCLISLG PEESCEFFHD PSMKSSQEGE VKKSLTVSPT  120
SNDGGYFFTL SKHPIS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4kop_A5e-481613110125Single-stranded DNA-binding protein WHY2, mit
4kop_B5e-481613110125Single-stranded DNA-binding protein WHY2, mit
4kop_C5e-481613110125Single-stranded DNA-binding protein WHY2, mit
4kop_D5e-481613110125Single-stranded DNA-binding protein WHY2, mit
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008803798.12e-58PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial-like isoform X1
RefseqXP_008803799.17e-59PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial-like isoform X2
SwissprotQ8VYF74e-48WHY2_ARATH; Single-stranded DNA-binding protein WHY2, mitochondrial
TrEMBLB8AI567e-52B8AI56_ORYSI; Putative uncharacterized protein
TrEMBLI1NXF67e-52I1NXF6_ORYGL; Uncharacterized protein
TrEMBLQ6ET437e-52Q6ET43_ORYSJ; Os02g0158400 protein
STRINGBGIOSGA007096-PA2e-51(Oryza sativa Indica Group)
STRINGLOC_Os02g06370.12e-51(Oryza sativa Japonica Group)
STRINGORGLA02G0041200.12e-51(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30123885
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71260.13e-42WHIRLY 2